![]() | Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
![]() | Fold c.47: Thioredoxin fold [52832] (3 superfamilies) |
![]() | Superfamily c.47.1: Thioredoxin-like [52833] (10 families) ![]() |
![]() | Family c.47.1.10: Glutathione peroxidase-like [52901] (5 proteins) |
![]() | Protein Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) [52906] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [52908] (1 PDB entry) |
![]() | Domain d1qmva_: 1qmv A: [33066] |
PDB Entry: 1qmv (more details), 1.7 Å
SCOP Domain Sequences for d1qmva_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens)} sgnarigkpapdfkatavvdgafkevklsdykgkyvvlffypldftfvapteiiafsnra edfrklgcevlgvsvdsqfthlawintprkegglgplniplladvtrrlsedygvlktde giayrglfiidgkgvlrqitvndlpvgrsvdealrlvqafqytdehgevcpagwkpgsdt ikpnvddskeyfskhn
Timeline for d1qmva_: