Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Arabidopsis thaliana [TaxId:3702] [324612] (13 PDB entries) |
Domain d5ecmf2: 5ecm F:84-217 [330658] Other proteins in same PDB: d5ecmc1, d5ecmf1 automated match to d2vo4a2 complexed with gsh, jaa, leu |
PDB Entry: 5ecm (more details), 1.6 Å
SCOPe Domain Sequences for d5ecmf2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ecmf2 a.45.1.0 (F:84-217) automated matches {Arabidopsis thaliana [TaxId: 3702]} ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse kivayaaeyrknnl
Timeline for d5ecmf2: