SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ecmf2 (5ecm F:84-217)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (60 species)
    not a true protein
  7. 2281311Species Arabidopsis thaliana [TaxId:3702] [324612] (11 PDB entries)
  8. 2287357Domain d5ecmf2: 5ecm F:84-217 [330658]
    Other proteins in same PDB: d5ecmc1, d5ecmf1
    automated match to d2vo4a2
    complexed with gsh, jaa, leu

Details for d5ecmf2

PDB Entry: 5ecm (more details), 1.6 Å

PDB Description: crystal structure of fin219-fip1 complex with ja and leu
PDB Compounds: (F:) Glutathione S-transferase U20

SCOPe Domain Sequences for d5ecmf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ecmf2 a.45.1.0 (F:84-217) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp
yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse
kivayaaeyrknnl

SCOPe Domain Coordinates for d5ecmf2:

Click to download the PDB-style file with coordinates for d5ecmf2.
(The format of our PDB-style files is described here.)

Timeline for d5ecmf2:

  • d5ecmf2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5ecmf1