Lineage for d5if5a_ (5if5 A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2223731Fold e.77: PA C-terminal domain-like [254112] (1 superfamily)
    Pfam PF00603; PubMed 18615018; complex fold with N-terminal a+b domain and C-terminal all-a domain
  4. 2223732Superfamily e.77.1: PA C-terminal domain-like [254132] (1 family) (S)
  5. 2223733Family e.77.1.1: PA C-terminal domain-like [254167] (2 protein domains)
  6. 2223737Protein automated matches [254658] (4 species)
    not a true protein
  7. 2286700Species Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId:381518] [330001] (9 PDB entries)
  8. 2287354Domain d5if5a_: 5if5 A: [330655]
    automated match to d3cm8a_
    complexed with 6b0, dms, edo

Details for d5if5a_

PDB Entry: 5if5 (more details), 2.25 Å

PDB Description: crystal structure of polymerase acid protein (pa) from influenza a virus, wilson-smith/1933 (h1n1) bound to ebsi-39 (2,3- dichlorophenyl)methanol
PDB Compounds: (A:) Polymerase acidic protein

SCOPe Domain Sequences for d5if5a_:

Sequence, based on SEQRES records: (download)

>d5if5a_ e.77.1.1 (A:) automated matches {Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
prplrlpdgppcsqrskfllmdalklsiedpshegegiplydaikcmrtffgwkepnvvk
phekginpnyllswkqvlaelqdieneekiprtknmkktsqlkwalgenmapekvdfddc
kdvgdlkqydsdepelrslaswiqnefnkaceltdsswieldeigedaapiehiasmrrn
yftaevshcrateyimkgvyintallnascaamddfqlipmiskcrtkegrrktnlygfi
ikgrshlrndtdvvnfvsmefsltdprlephkwekycvlevgdmllrsaighvsrpmfly
vrtngtskikmkwgmemrrcllqslqqiesmieaessvkekdmtkeffenksetwpvges
pkgveegsigkvcrtllaksvfnslyaspqlegfsaesrklllivqalrdnlepgtfdlg
glyeaieeclindpwvllnaswfnsflth

Sequence, based on observed residues (ATOM records): (download)

>d5if5a_ e.77.1.1 (A:) automated matches {Influenza a virus (strain a/wilson-smith/1933 h1n1) [TaxId: 381518]}
prplrlpdgppcsqrskfllmdalklsiedpgiplydaikcmrtffgwkepnvvkphekg
inpnyllswkqvlaelqdieneekiprtknmkktsqlkwalgeelrslaswiqnefnkac
eltdsswieldeigedaapiehiasmrrnyftaevshcrateyimkgvyintallnasca
amddfqlipmiskcrtkegrrktnlygfiikgrshlrndtdvvnfvsmefsltdprleph
kwekycvlevgdmllrsaighvsrpmflyvrtngtskikmkwgmemrrcllqslqqiesm
ieaessvkekdmtkeffenkespkgveegsigkvcrtllaksvfnslyaspqlegfsaes
rklllivqalrdnlefdlgglyeaieeclindpwvllnaswfnsflth

SCOPe Domain Coordinates for d5if5a_:

Click to download the PDB-style file with coordinates for d5if5a_.
(The format of our PDB-style files is described here.)

Timeline for d5if5a_:

  • d5if5a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08