Lineage for d5ggza_ (5ggz A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190933Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2190934Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2190935Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 protein domains)
  6. 2191125Protein automated matches [190229] (11 species)
    not a true protein
  7. 2191138Species Human (Homo sapiens) [TaxId:9606] [187292] (123 PDB entries)
  8. 2287350Domain d5ggza_: 5ggz A: [330651]
    automated match to d2xjxa_
    complexed with 6tn

Details for d5ggza_

PDB Entry: 5ggz (more details), 2.02 Å

PDB Description: crystal structure of novel inhibitor bound with hsp90
PDB Compounds: (A:) Heat shock protein HSP 90-alpha

SCOPe Domain Sequences for d5ggza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ggza_ d.122.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagvdismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d5ggza_:

Click to download the PDB-style file with coordinates for d5ggza_.
(The format of our PDB-style files is described here.)

Timeline for d5ggza_:

  • d5ggza_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08