Lineage for d5ecmc2 (5ecm C:84-217)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996612Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1996613Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1997413Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1997414Protein automated matches [226831] (61 species)
    not a true protein
  7. 2281311Species Arabidopsis thaliana [TaxId:3702] [324612] (13 PDB entries)
  8. 2287348Domain d5ecmc2: 5ecm C:84-217 [330649]
    Other proteins in same PDB: d5ecmc1, d5ecmf1
    automated match to d2vo4a2
    complexed with gsh, jaa, leu

Details for d5ecmc2

PDB Entry: 5ecm (more details), 1.6 Å

PDB Description: crystal structure of fin219-fip1 complex with ja and leu
PDB Compounds: (C:) Glutathione S-transferase U20

SCOPe Domain Sequences for d5ecmc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ecmc2 a.45.1.0 (C:84-217) automated matches {Arabidopsis thaliana [TaxId: 3702]}
ffpsdpygraqarfwadfvdkkftdaqfkvwgkkgeeqeagkkefieavkileselgdkp
yfggdsfgyvdislitfsswfqayekfgnfsiesespkliawakrcmekesvskslpdse
kivayaaeyrknnl

SCOPe Domain Coordinates for d5ecmc2:

Click to download the PDB-style file with coordinates for d5ecmc2.
(The format of our PDB-style files is described here.)

Timeline for d5ecmc2:

  • d5ecmc2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5ecmc1