Lineage for d5i96a1 (5i96 A:41-452)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2138632Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2138633Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2138634Family c.77.1.1: Dimeric isocitrate & isopropylmalate dehydrogenases [53660] (4 protein domains)
    the active site is between the two identical subunits
  6. 2138768Protein automated matches [190072] (19 species)
    not a true protein
  7. 2138837Species Human (Homo sapiens) [TaxId:9606] [189131] (7 PDB entries)
  8. 2287347Domain d5i96a1: 5i96 A:41-452 [330648]
    Other proteins in same PDB: d5i96a2
    automated match to d1lwda_
    complexed with 69q, act, ca, gol, na, ndp; mutant

Details for d5i96a1

PDB Entry: 5i96 (more details), 1.55 Å

PDB Description: crystal structure of human mitochondrial isocitrate dehydrogenase (idh2) r140q mutant homodimer in complex with ag-221 (enasidenib) inhibitor.
PDB Compounds: (A:) Isocitrate dehydrogenase [NADP], mitochondrial

SCOPe Domain Sequences for d5i96a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i96a1 c.77.1.1 (A:41-452) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkrikvakpvvemdgdemtriiwqfikeklilphvdiqlkyfdlglpnrdqtddqvtids
alatqkysvavkcatitpdearveefklkkmwkspngtiqnilggtvfrepiickniprl
vpgwtkpitigrhahgdqykatdfvadragtfkmvftpkdgsgvkewevynfpaggvgmg
myntdesisgfahscfqyaiqkkwplymstkntilkaydgrfkdifqeifdkhyktdfdk
nkiwyehrliddmvaqvlkssggfvwacknydgdvqsdilaqgfgslglmtsvlvcpdgk
tieaeaahgtvtrhyrehqkgrptstnpiasifawtrglehrgkldgnqdlirfaqmlek
vcvetvesgamtkdlagcihglsnvklnehflnttdfldtiksnldralgrq

SCOPe Domain Coordinates for d5i96a1:

Click to download the PDB-style file with coordinates for d5i96a1.
(The format of our PDB-style files is described here.)

Timeline for d5i96a1:

  • d5i96a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5i96a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5i96b_