Lineage for d5dkma_ (5dkm A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058321Species Saccharopolyspora erythraea [TaxId:1836] [237652] (5 PDB entries)
  8. 2287338Domain d5dkma_: 5dkm A: [330639]
    automated match to d1kigh_

Details for d5dkma_

PDB Entry: 5dkm (more details), 0.92 Å

PDB Description: s. erythraea trypsin michaelis-menten complex
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d5dkma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dkma_ b.47.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]}
ivggedanvqdhpftvalvtpdgqqfcggtlaapnkvvtaahctvgsqpadinvvsgrtv
mssnegtvskvtnvwvhpeyqdaakgfdvsvltleapvkeapielakaddagyapdtaat
ilgwgntseggqqadhlqkatvpvnsddtckqaygeytpdamvcagvpeggvdtcqgdsg
gpmvvnnkligvtswgegcarpgkpgvyarvgayydvlmeqinagavsar

SCOPe Domain Coordinates for d5dkma_:

Click to download the PDB-style file with coordinates for d5dkma_.
(The format of our PDB-style files is described here.)

Timeline for d5dkma_:

  • d5dkma_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08