SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5dkma_ (5dkm A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058321Species Saccharopolyspora erythraea [TaxId:1836] [237652] (4 PDB entries)
  8. 2287338Domain d5dkma_: 5dkm A: [330639]
    automated match to d1kigh_

Details for d5dkma_

PDB Entry: 5dkm (more details), 0.92 Å

PDB Description: s. erythraea trypsin michaelis-menten complex
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d5dkma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dkma_ b.47.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]}
ivggedanvqdhpftvalvtpdgqqfcggtlaapnkvvtaahctvgsqpadinvvsgrtv
mssnegtvskvtnvwvhpeyqdaakgfdvsvltleapvkeapielakaddagyapdtaat
ilgwgntseggqqadhlqkatvpvnsddtckqaygeytpdamvcagvpeggvdtcqgdsg
gpmvvnnkligvtswgegcarpgkpgvyarvgayydvlmeqinagavsar

SCOPe Domain Coordinates for d5dkma_:

Click to download the PDB-style file with coordinates for d5dkma_.
(The format of our PDB-style files is described here.)

Timeline for d5dkma_:

  • d5dkma_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08