SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5fw6a_ (5fw6 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2034780Fold b.3: Prealbumin-like [49451] (7 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2035040Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) (S)
  5. 2035041Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 protein domains)
    automatically mapped to Pfam PF00576
  6. 2035042Protein Transthyretin (synonym: prealbumin) [49474] (5 species)
    sandwich; 8 strands in 2 sheets
  7. 2035063Species Human (Homo sapiens) [TaxId:9606] [49475] (266 PDB entries)
    Uniprot P02766 31-143
  8. 2287337Domain d5fw6a_: 5fw6 A: [330638]
    automated match to d1ttaa_
    mutant

Details for d5fw6a_

PDB Entry: 5fw6 (more details), 1.3 Å

PDB Description: structure of human transthyretin mutant a108v
PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d5fw6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5fw6a_ b.3.4.1 (A:) Transthyretin (synonym: prealbumin) {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytivallspysysttavvtnp

SCOPe Domain Coordinates for d5fw6a_:

Click to download the PDB-style file with coordinates for d5fw6a_.
(The format of our PDB-style files is described here.)

Timeline for d5fw6a_:

  • d5fw6a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08

View in 3D
Domains from other chains:
(mouse over for more information)
d5fw6b_