Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (24 species) not a true protein |
Species Saccharopolyspora erythraea [TaxId:1836] [237652] (5 PDB entries) |
Domain d5dk1a1: 5dk1 A:1-227 [330636] Other proteins in same PDB: d5dk1a2 automated match to d1kigh_ |
PDB Entry: 5dk1 (more details), 0.94 Å
SCOPe Domain Sequences for d5dk1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dk1a1 b.47.1.0 (A:1-227) automated matches {Saccharopolyspora erythraea [TaxId: 1836]} ivggedanvqdhpftvalvtpdgqqfcggtlaapnkvvtaahctvgsqpadinvvsgrtv mssnegtvskvtnvwvhpeyqdaakgfdvsvltleapvkeapielakaddagyapdtaat ilgwgntseggqqadhlqkatvpvnsddtckqaygeytpnamvcagvpeggvdtcqgdsg gpmvvnnkligvtswgegcarpgkpgvyarvgayydvlmeqinagav
Timeline for d5dk1a1: