SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5b3ka_ (5b3k A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2102350Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2102815Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2102816Protein automated matches [190158] (22 species)
    not a true protein
  7. 2287331Species Pseudomonas aeruginosa [TaxId:208964] [330632] (2 PDB entries)
  8. 2287334Domain d5b3ka_: 5b3k A: [330635]
    automated match to d2m6sa_
    complexed with so4; mutant

Details for d5b3ka_

PDB Entry: 5b3k (more details), 1.7 Å

PDB Description: c101a mutant of flavodoxin from pseudomonas aeruginosa
PDB Compounds: (A:) Uncharacterized protein PA3435

SCOPe Domain Sequences for d5b3ka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b3ka_ c.23.5.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]}
mkvailsgsvygtaeevarhaqkllsaagleashlprasldelkafapeaflvvtsttgm
gelpdnlqplyyairdqlpawhglpggviglgdssygdtfagggeqvrelfgelgvrevl
pmlrldasetvtpetdaepwlaefaaalkg

SCOPe Domain Coordinates for d5b3ka_:

Click to download the PDB-style file with coordinates for d5b3ka_.
(The format of our PDB-style files is described here.)

Timeline for d5b3ka_:

  • d5b3ka_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-08