Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (31 species) not a true protein |
Species Pseudomonas aeruginosa [TaxId:208964] [330632] (2 PDB entries) |
Domain d5b3la_: 5b3l A: [330634] automated match to d2m6sa_ complexed with so4; mutant |
PDB Entry: 5b3l (more details), 1.8 Å
SCOPe Domain Sequences for d5b3la_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b3la_ c.23.5.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 208964]} mkvailsgsvygtaeevarhaqkllsaagleashlprasldelkafapeaflvvtsttgm gelpdnlqplyyairdqlpawhglpggviglgdssygdtfsgggeqvrelfgelgvrevl pmlrldasetvtpetdaepwlaefaaalkg
Timeline for d5b3la_: