Lineage for d5dj7a_ (5dj7 A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2064170Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2064171Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2066902Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2066903Protein automated matches [190438] (24 species)
    not a true protein
  7. 2067102Species Saccharopolyspora erythraea [TaxId:1836] [237652] (5 PDB entries)
  8. 2067105Domain d5dj7a_: 5dj7 A: [330631]
    automated match to d1kigh_

Details for d5dj7a_

PDB Entry: 5dj7 (more details), 0.87 Å

PDB Description: s. erythraea trypsin acyl-enzyme
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d5dj7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dj7a_ b.47.1.0 (A:) automated matches {Saccharopolyspora erythraea [TaxId: 1836]}
ivggedanvqdhpftvalvtpdgqqfcggtlaapnkvvtaahctvgsqpadinvvsgrtv
mssnegtvskvtnvwvhpeyqdaakgfdvsvltleapvkeapielakaddagyapdtaat
ilgwgntseggqqadhlqkatvpvnsddtckqaygeytpdamvcagvpeggvdtcqgdsg
gpmvvnnkligvtswgegcarpgkpgvyarvgayydvlmeqinagavsar

SCOPe Domain Coordinates for d5dj7a_:

Click to download the PDB-style file with coordinates for d5dj7a_.
(The format of our PDB-style files is described here.)

Timeline for d5dj7a_: