SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5urqe1 (5urq E:1-481)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2287181Species Campylobacter jejuni [TaxId:398000] [330482] (4 PDB entries)
  8. 2287320Domain d5urqe1: 5urq E:1-481 [330621]
    Other proteins in same PDB: d5urqa2, d5urqb2, d5urqc2, d5urqd2, d5urqe2, d5urqf2, d5urqg2, d5urqh2
    automated match to d4mz8b_
    complexed with 8l7, imp, k

Details for d5urqe1

PDB Entry: 5urq (more details), 2.7 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p176
PDB Compounds: (E:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5urqe1:

Sequence, based on SEQRES records: (download)

>d5urqe1 c.1.5.0 (E:1-481) automated matches {Campylobacter jejuni [TaxId: 398000]}
mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm
arlgglgvihknmdiasqvrevkrvkksesggikdlkkrkeypdankdnfgrlrvgaaig
vgqmdrvdalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakal
ceagvdavkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdi
akalavgassvmigsllagtdespgelftyqgrqyksyrgmgslgamqkgssdryfqqgt
aqdklvpegiegrvpyvgsirsvvhqllgglrssmgyvgakdiedfqkraefveittagl
keshvhdvtitheapnyk

Sequence, based on observed residues (ATOM records): (download)

>d5urqe1 c.1.5.0 (E:1-481) automated matches {Campylobacter jejuni [TaxId: 398000]}
mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm
arlgglgvihknmdiasqvrevkrvkkseypdankdnfgrlrvgaaigvgqmdrvdalve
agvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvdavkvgi
gpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavgassvm
igsllagtdespgelftyqgrqyksyrgmgslgamqkgssdklvpegiegrvpyvgsirs
vvhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnyk

SCOPe Domain Coordinates for d5urqe1:

Click to download the PDB-style file with coordinates for d5urqe1.
(The format of our PDB-style files is described here.)

Timeline for d5urqe1:

  • d5urqe1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02