SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t8hb_ (5t8h B:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2058814Fold b.50: Acid proteases [50629] (1 superfamily)
    barrel, closed; n=6, S=10, complex topology
  4. 2058815Superfamily b.50.1: Acid proteases [50630] (4 families) (S)
  5. 2058816Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 protein domains)
    dimer of identical mono-domain chains, each containing (6,10) barrel
  6. 2058832Protein Human immunodeficiency virus type 1 protease [50632] (9 species)
  7. 2059066Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (468 PDB entries)
    Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167
  8. 2287316Domain d5t8hb_: 5t8h B: [330617]
    automated match to d3s43b_
    complexed with 478, dod; mutant

Details for d5t8hb_

PDB Entry: 5t8h (more details), 1.85 Å

PDB Description: joint x-ray/neutron structure of hiv-1 protease triple mutant (v32i, i47v,v82i) with amprenavir at ph 6.0
PDB Compounds: (B:) Protease

SCOPe Domain Sequences for d5t8hb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t8hb_ b.50.1.1 (B:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqitlwkrplvtikiggqlkealldtgaddtiieemslpgrwkpkmvggiggfikvrqyd
qiiieiaghkaigtvlvgptpiniigrnlltqigatlnf

SCOPe Domain Coordinates for d5t8hb_:

Click to download the PDB-style file with coordinates for d5t8hb_.
(The format of our PDB-style files is described here.)

Timeline for d5t8hb_:

  • d5t8hb_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02