Lineage for d5urrd1 (5urr D:1-486)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2287184Species Bacillus anthracis [TaxId:1392] [330485] (5 PDB entries)
  8. 2287314Domain d5urrd1: 5urr D:1-486 [330615]
    Other proteins in same PDB: d5urra2, d5urrb2, d5urrc2, d5urrd2, d5urre2, d5urrf2, d5urrg2, d5urrh2
    automated match to d4q33e_
    complexed with 8l7, imp, k

Details for d5urrd1

PDB Entry: 5urr (more details), 2.45 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from bacillus anthracis in the complex with imp and the inhibitor p176
PDB Compounds: (D:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5urrd1:

Sequence, based on SEQRES records: (download)

>d5urrd1 c.1.5.0 (D:1-486) automated matches {Bacillus anthracis [TaxId: 1392]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgamekgskdryfqegnkklvpegiegrvpykgp
ladtvhqlvgglragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys

Sequence, based on observed residues (ATOM records): (download)

>d5urrd1 c.1.5.0 (D:1-486) automated matches {Bacillus anthracis [TaxId: 1392]}
mweskfvkegltfddvllvpaksdvlprevsvktvlseslqlniplisagmdtvteadma
iamarqgglgiihknmsieqqaeqvdkvkrsggllvgaavgvtadamtridalvkasvda
ivldtahghsqgvidkvkevrakypslniiagnvataeatkalieaganvvkvgigpgsi
cttrvvagvgvpqltavydcatearkhgipviadggikysgdmvkalaagahvvmlgsmf
agvaespgeteiyqgrqfkvyrgmgsvgamekgklvpegiegrvpykgpladtvhqlvgg
lragmgycgaqdleflrenaqfirmsgaglleshphhvqitkeapnys

SCOPe Domain Coordinates for d5urrd1:

Click to download the PDB-style file with coordinates for d5urrd1.
(The format of our PDB-style files is described here.)

Timeline for d5urrd1:

  • d5urrd1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02