SCOPe 2.06: Domain d5wtza1: 5wtz A:1-210

Lineage for d5wtza1 (5wtz A:1-210)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries)

8. Domain d5wtza1: 5wtz A:1-210 [330600]
   Other proteins in same PDB: d5wtza3
   automated match to d1giqa1
   complexed with nad

Details for d5wtza1

PDB Entry: 5wtz, 1.8 Å

PDB Description: crystal structure of c. perfringens iota-like enterotoxin cpile-a with nad+

PDB Compounds: (A:) Binary enterotoxin of Clostridium perfringens component a

SCOPe Domain Sequences for d5wtza1:

Sequence; same for both SEQRES and ATOM records:

>d5wtza1 d.166.1.0 (A:1-210) automated matches {Clostridium perfringens [TaxId: 1502]}
mlddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfa
ldnyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideea
innfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvli
dqgyslkatglsivtikgkqyakvdadlik

Timeline for d5wtza1:

• d5wtza1 is new in SCOPe 2.06-stable
  
• d5wtza1 appears in SCOPe 2.07
  
• d5wtza1 appears in the current release, SCOPe 2.08