SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wtza1 (5wtz A:1-210)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208074Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2208075Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2208361Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2208362Protein automated matches [191197] (9 species)
    not a true protein
  7. 2281344Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries)
  8. 2287299Domain d5wtza1: 5wtz A:1-210 [330600]
    Other proteins in same PDB: d5wtza3
    automated match to d1giqa1
    complexed with nad

Details for d5wtza1

PDB Entry: 5wtz (more details), 1.8 Å

PDB Description: crystal structure of c. perfringens iota-like enterotoxin cpile-a with nad+
PDB Compounds: (A:) Binary enterotoxin of Clostridium perfringens component a

SCOPe Domain Sequences for d5wtza1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wtza1 d.166.1.0 (A:1-210) automated matches {Clostridium perfringens [TaxId: 1502]}
mlddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfa
ldnyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideea
innfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvli
dqgyslkatglsivtikgkqyakvdadlik

SCOPe Domain Coordinates for d5wtza1:

Click to download the PDB-style file with coordinates for d5wtza1.
(The format of our PDB-style files is described here.)

Timeline for d5wtza1:

  • d5wtza1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02