| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) ![]() |
| Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
| Protein automated matches [191197] (13 species) not a true protein |
| Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries) |
| Domain d5wtza1: 5wtz A:1-210 [330600] Other proteins in same PDB: d5wtza3 automated match to d1giqa1 complexed with nad |
PDB Entry: 5wtz (more details), 1.8 Å
SCOPe Domain Sequences for d5wtza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5wtza1 d.166.1.0 (A:1-210) automated matches {Clostridium perfringens [TaxId: 1502]}
mlddnrpmdfakdknsatlwakkrkqvwlnnlskaestsinnyiknsseinsysikkkfa
ldnyegietlnedlknistavkksmltkplyvyyyeandkfgfnqnlessldsniideea
innfakkisdtnfiqdgfkdvtmtepdinsklpilvhlklptntpaasygndeenlrvli
dqgyslkatglsivtikgkqyakvdadlik
Timeline for d5wtza1: