Lineage for d5urqf1 (5urq F:1-481)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080656Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2080703Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2080704Protein automated matches [227084] (14 species)
    not a true protein
  7. 2287181Species Campylobacter jejuni [TaxId:398000] [330482] (4 PDB entries)
  8. 2287290Domain d5urqf1: 5urq F:1-481 [330591]
    Other proteins in same PDB: d5urqa2, d5urqb2, d5urqc2, d5urqd2, d5urqe2, d5urqf2, d5urqg2, d5urqh2
    automated match to d4mz8b_
    complexed with 8l7, imp, k

Details for d5urqf1

PDB Entry: 5urq (more details), 2.7 Å

PDB Description: crystal structure of the catalytic domain of the inosine monophosphate dehydrogenase from campylobacter jejuni in the complex with inhibitor p176
PDB Compounds: (F:) inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5urqf1:

Sequence, based on SEQRES records: (download)

>d5urqf1 c.1.5.0 (F:1-481) automated matches {Campylobacter jejuni [TaxId: 398000]}
mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm
arlgglgvihknmdiasqvrevkrvkksesggikdlkkrkeypdankdnfgrlrvgaaig
vgqmdrvdalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakal
ceagvdavkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdi
akalavgassvmigsllagtdespgelftyqgrqyksyrgmgslgamqkgssdryfqqgt
aqdklvpegiegrvpyvgsirsvvhqllgglrssmgyvgakdiedfqkraefveittagl
keshvhdvtitheapnyk

Sequence, based on observed residues (ATOM records): (download)

>d5urqf1 c.1.5.0 (F:1-481) automated matches {Campylobacter jejuni [TaxId: 398000]}
mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm
arlgglgvihknmdiasqvrevkrvkksesgkeypdankdnfgrlrvgaaigvgqmdrvd
alveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvdav
kvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavga
ssvmigsllagtdespgelftyqgrqyksyrgmgslgamqklvpegiegrvpyvgsirsv
vhqllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnyk

SCOPe Domain Coordinates for d5urqf1:

Click to download the PDB-style file with coordinates for d5urqf1.
(The format of our PDB-style files is described here.)

Timeline for d5urqf1:

  • d5urqf1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02