SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tkta_ (5tkt A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058190Species Human (Homo sapiens) [TaxId:9606] [187421] (60 PDB entries)
  8. 2287288Domain d5tkta_: 5tkt A: [330589]
    automated match to d1p57b_
    complexed with 7ds, edo, so4

Details for d5tkta_

PDB Entry: 5tkt (more details), 2.12 Å

PDB Description: factor xia in complex with the inhibitor methyl ((12e,15s)-15-(((2e)- 3-(5-chloro-2-(1h-tetrazol-1-yl)phenyl)-2-propenoyl)amino)-9-oxo-8, 17,19-triazatricyclo[14.2.1.0~2,7~]nonadeca-1(18),2,4,6,12,16(19)- hexaen-5-yl)carbamate
PDB Compounds: (A:) Factor XIa (Light Chain)

SCOPe Domain Sequences for d5tkta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tkta_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d5tkta_:

Click to download the PDB-style file with coordinates for d5tkta_.
(The format of our PDB-style files is described here.)

Timeline for d5tkta_:

  • d5tkta_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02