SCOPe 2.06: Domain d5wu0a2: 5wu0 A:211-419

Lineage for d5wu0a2 (5wu0 A:211-419)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (9 species)
   not a true protein

7. Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries)

8. Domain d5wu0a2: 5wu0 A:211-419 [330567]
   automated match to d1giqa2
   complexed with nai

Details for d5wu0a2

PDB Entry: 5wu0, 2.25 Å

PDB Description: crystal structure of c. perfringens iota-like enterotoxin cpile-a with nadh

PDB Compounds: (A:) Binary enterotoxin of Clostridium perfringens component a

SCOPe Domain Sequences for d5wu0a2:

Sequence; same for both SEQRES and ATOM records:

>d5wu0a2 d.166.1.0 (A:211-419) automated matches {Clostridium perfringens [TaxId: 1502]}
qlnfendvisasqwgeenyapwlkeltsnelrdinnylgggytainkylldgtigentsk
edleekisnissalkkrkipediityrrmgpnefgldlnspdydfnkvenvskfkekwlg
ktipvktfisttvlsnnisafakrklilrlhlpngsnaayvsvaegykneyevlidhgys
ykidniteyydesslggktnkliidatli

Timeline for d5wu0a2:

• d5wu0a2 is new in SCOPe 2.06-stable
  
• d5wu0a2 appears in SCOPe 2.07
  
• d5wu0a2 appears in the current release, SCOPe 2.08