SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5wu0a2 (5wu0 A:211-419)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2208074Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2208075Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2208361Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2208362Protein automated matches [191197] (9 species)
    not a true protein
  7. 2281344Species Clostridium perfringens [TaxId:1502] [324645] (5 PDB entries)
  8. 2287266Domain d5wu0a2: 5wu0 A:211-419 [330567]
    automated match to d1giqa2
    complexed with nai

Details for d5wu0a2

PDB Entry: 5wu0 (more details), 2.25 Å

PDB Description: crystal structure of c. perfringens iota-like enterotoxin cpile-a with nadh
PDB Compounds: (A:) Binary enterotoxin of Clostridium perfringens component a

SCOPe Domain Sequences for d5wu0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wu0a2 d.166.1.0 (A:211-419) automated matches {Clostridium perfringens [TaxId: 1502]}
qlnfendvisasqwgeenyapwlkeltsnelrdinnylgggytainkylldgtigentsk
edleekisnissalkkrkipediityrrmgpnefgldlnspdydfnkvenvskfkekwlg
ktipvktfisttvlsnnisafakrklilrlhlpngsnaayvsvaegykneyevlidhgys
ykidniteyydesslggktnkliidatli

SCOPe Domain Coordinates for d5wu0a2:

Click to download the PDB-style file with coordinates for d5wu0a2.
(The format of our PDB-style files is described here.)

Timeline for d5wu0a2:

  • d5wu0a2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5wu0a1