Lineage for d5tx6c_ (5tx6 C:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2232568Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
    disulfide-rich fold; common core is all-beta
  4. 2232569Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families) (S)
  5. 2232656Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 protein domains)
  6. 2232729Protein TGF-beta2 [57510] (2 species)
  7. 2287150Species Mus musculus [TaxId:10090] [330451] (2 PDB entries)
  8. 2287253Domain d5tx6c_: 5tx6 C: [330554]
    automated match to d2tgia_
    complexed with ca; mutant

Details for d5tx6c_

PDB Entry: 5tx6 (more details), 2.75 Å

PDB Description: structure of tgf-beta2 derivative with deletion of residues 52-71 and 10 single amino acid mutations (mmtgf-beta2-7m)
PDB Compounds: (C:) Transforming growth factor beta-2

SCOPe Domain Sequences for d5tx6c_:

Sequence, based on SEQRES records: (download)

>d5tx6c_ g.17.1.2 (C:) TGF-beta2 {Mus musculus [TaxId: 10090]}
aldaaycfrnvqdncclrplyidfrkdlgwkwihepkgynanfcagacpyraskspscvs
qdlepltivyyvgrkpkveqlsnmivksckcs

Sequence, based on observed residues (ATOM records): (download)

>d5tx6c_ g.17.1.2 (C:) TGF-beta2 {Mus musculus [TaxId: 10090]}
aldaaycfrnvqdncclrplyidfrkdlgwkwihepkgynanfcascvsqdlepltivyy
vgrkpkveqlsnmivksckcs

SCOPe Domain Coordinates for d5tx6c_:

Click to download the PDB-style file with coordinates for d5tx6c_.
(The format of our PDB-style files is described here.)

Timeline for d5tx6c_:

  • d5tx6c_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02