Lineage for d5x5ha1 (5x5h A:3-385)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (119 species)
    not a true protein
  7. 2287245Species Corynebacterium glutamicum [TaxId:196627] [330546] (1 PDB entry)
  8. 2287246Domain d5x5ha1: 5x5h A:3-385 [330547]
    Other proteins in same PDB: d5x5ha2
    automated match to d4mkka_
    complexed with gol, mg, plp

Details for d5x5ha1

PDB Entry: 5x5h (more details), 1.51 Å

PDB Description: crystal strcuture of metb from corynebacterium glutamicum
PDB Compounds: (A:) Cystathionine beta-lyases/cystathionine gamma-synthases

SCOPe Domain Sequences for d5x5ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x5ha1 c.67.1.0 (A:3-385) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
fdpntqgfstasihagyepddyygsintpiyasttfaqnapnelrkgyeytrvgnptiva
leqtvaalegakygrafssgmaatdilfriilkpgdhivlgndayggtyrlidtvftawg
veytvvdtsvveevkaaikdntkliwvetptnpalgitdieavakltegtnaklvvdntf
aspylqqplklgahavlhsttkyigghsdvvgglvvtndqemdeellfmqggigpipsvf
dayltarglktlavrmdrhcdnaekiaefldsrpevstvlypglknhpghevaakqmkrf
ggmisvrfaggeeaakkfctstkliclaeslggvesllehpatmthqsaagsqlevprdl
vrisigiediedlladveqalnn

SCOPe Domain Coordinates for d5x5ha1:

Click to download the PDB-style file with coordinates for d5x5ha1.
(The format of our PDB-style files is described here.)

Timeline for d5x5ha1:

  • d5x5ha1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5x5ha2