SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x5ha1 (5x5h A:3-385)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (111 species)
    not a true protein
  7. 2287245Species Corynebacterium glutamicum [TaxId:196627] [330546] (1 PDB entry)
  8. 2287246Domain d5x5ha1: 5x5h A:3-385 [330547]
    Other proteins in same PDB: d5x5ha2
    automated match to d4mkka_
    complexed with gol, mg, plp

Details for d5x5ha1

PDB Entry: 5x5h (more details), 1.51 Å

PDB Description: crystal strcuture of metb from corynebacterium glutamicum
PDB Compounds: (A:) Cystathionine beta-lyases/cystathionine gamma-synthases

SCOPe Domain Sequences for d5x5ha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x5ha1 c.67.1.0 (A:3-385) automated matches {Corynebacterium glutamicum [TaxId: 196627]}
fdpntqgfstasihagyepddyygsintpiyasttfaqnapnelrkgyeytrvgnptiva
leqtvaalegakygrafssgmaatdilfriilkpgdhivlgndayggtyrlidtvftawg
veytvvdtsvveevkaaikdntkliwvetptnpalgitdieavakltegtnaklvvdntf
aspylqqplklgahavlhsttkyigghsdvvgglvvtndqemdeellfmqggigpipsvf
dayltarglktlavrmdrhcdnaekiaefldsrpevstvlypglknhpghevaakqmkrf
ggmisvrfaggeeaakkfctstkliclaeslggvesllehpatmthqsaagsqlevprdl
vrisigiediedlladveqalnn

SCOPe Domain Coordinates for d5x5ha1:

Click to download the PDB-style file with coordinates for d5x5ha1.
(The format of our PDB-style files is described here.)

Timeline for d5x5ha1:

  • d5x5ha1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5x5ha2