SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5in1a_ (5in1 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2047511Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2047686Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 2047687Protein automated matches [191139] (4 species)
    not a true protein
  7. 2287238Species Oryza sativa [TaxId:4530] [330539] (1 PDB entry)
  8. 2287242Domain d5in1a_: 5in1 A: [330543]
    automated match to d2f5kf_
    complexed with edo, so4

Details for d5in1a_

PDB Entry: 5in1 (more details), 1.4 Å

PDB Description: crystal structure of the mrg701 chromodomain
PDB Compounds: (A:) mrg701

SCOPe Domain Sequences for d5in1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5in1a_ b.34.13.0 (A:) automated matches {Oryza sativa [TaxId: 4530]}
sfkegervlayhgpllyeakvqksenkedewryhvhylgwskswdewvtndrllkltden
irkqqeleksq

SCOPe Domain Coordinates for d5in1a_:

Click to download the PDB-style file with coordinates for d5in1a_.
(The format of our PDB-style files is described here.)

Timeline for d5in1a_:

  • d5in1a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02