Lineage for d5in1a_ (5in1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785217Family b.34.13.0: automated matches [191621] (1 protein)
    not a true family
  6. 2785218Protein automated matches [191139] (6 species)
    not a true protein
  7. 2785252Species Rice (Oryza sativa) [TaxId:4530] [330539] (1 PDB entry)
  8. 2785253Domain d5in1a_: 5in1 A: [330543]
    automated match to d2f5kf_
    complexed with edo, so4

Details for d5in1a_

PDB Entry: 5in1 (more details), 1.4 Å

PDB Description: crystal structure of the mrg701 chromodomain
PDB Compounds: (A:) mrg701

SCOPe Domain Sequences for d5in1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5in1a_ b.34.13.0 (A:) automated matches {Rice (Oryza sativa) [TaxId: 4530]}
sfkegervlayhgpllyeakvqksenkedewryhvhylgwskswdewvtndrllkltden
irkqqeleksq

SCOPe Domain Coordinates for d5in1a_:

Click to download the PDB-style file with coordinates for d5in1a_.
(The format of our PDB-style files is described here.)

Timeline for d5in1a_: