Class b: All beta proteins [48724] (180 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.13: Chromo domain-like [54160] (4 families) SH3-like barrel is capped by a C-terminal helix |
Family b.34.13.0: automated matches [191621] (1 protein) not a true family |
Protein automated matches [191139] (6 species) not a true protein |
Species Rice (Oryza sativa) [TaxId:4530] [330539] (1 PDB entry) |
Domain d5in1b_: 5in1 B: [330540] automated match to d2f5kf_ complexed with edo, so4 |
PDB Entry: 5in1 (more details), 1.4 Å
SCOPe Domain Sequences for d5in1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5in1b_ b.34.13.0 (B:) automated matches {Rice (Oryza sativa) [TaxId: 4530]} sfkegervlayhgpllyeakvqksenkedewryhvhylgwskswdewvtndrllkltden irkqqeleksq
Timeline for d5in1b_: