SCOPe 2.06: Domain d5us8b2: 5us8 B:190-442

Lineage for d5us8b2 (5us8 B:190-442)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.210: Argininosuccinate synthetase, C-terminal domain [69863] (1 superfamily)
   unusual fold

4. Superfamily d.210.1: Argininosuccinate synthetase, C-terminal domain [69864] (2 families)

5. Family d.210.1.1: Argininosuccinate synthetase, C-terminal domain [69865] (2 proteins)

6. Protein automated matches [330535] (1 species)
   not a true protein

7. Species Bordetella pertussis [TaxId:257313] [330536] (1 PDB entry)

8. Domain d5us8b2: 5us8 B:190-442 [330537]
   Other proteins in same PDB: d5us8a1, d5us8a3, d5us8b1, d5us8b3
   automated match to d1k92a2
   complexed with adn, epe, pge, so4

Details for d5us8b2

PDB Entry: 5us8, 2.15 Å

PDB Description: 2.15 angstrom resolution crystal structure of argininosuccinate synthase from bordetella pertussis

PDB Compounds: (B:) argininosuccinate synthase

SCOPe Domain Sequences for d5us8b2:

Sequence; same for both SEQRES and ATOM records:

>d5us8b2 d.210.1.1 (B:190-442) automated matches {Bordetella pertussis [TaxId: 257313]}
aystdsnmlgatheakdlellsagirivqpimgvafwqdsvqikaeevtvrfeegqpval
ngveyadpvellleanriggrhglgmsdqienriieaksrgiyeapglallfiayerlvt
gihnedtieqyrengrklgrllyqgrwfdpqaimlretaqrwvaraitgevtlelrrgnd
ysllntesanltyaperlsmekvenapftpadrigqltmrnldivdtreklftyvktgll
apsagsalpqikd

Timeline for d5us8b2:

• d5us8b2 is new in SCOPe 2.06-stable
  
• d5us8b2 appears in SCOPe 2.07
  
• d5us8b2 appears in the current release, SCOPe 2.08