Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies) core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.26.2: Adenine nucleotide alpha hydrolases-like [52402] (7 families) share similar mode of ligand (Adenosine group) binding can be subdivided into two group with closer relationships within each group than between the groups; the first three families form one group whereas the last two families form the other group |
Family c.26.2.0: automated matches [191320] (1 protein) not a true family |
Protein automated matches [190116] (24 species) not a true protein |
Species Bordetella pertussis [TaxId:257313] [330533] (1 PDB entry) |
Domain d5us8b1: 5us8 B:1-189 [330534] Other proteins in same PDB: d5us8a2, d5us8a3, d5us8b2, d5us8b3 automated match to d1k92a1 complexed with adn, epe, pge, so4 |
PDB Entry: 5us8 (more details), 2.15 Å
SCOPe Domain Sequences for d5us8b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5us8b1 c.26.2.0 (B:1-189) automated matches {Bordetella pertussis [TaxId: 257313]} mttilpnlptgqkvgiafsggldtsaallwmrqkgavpyaytanlgqpdepdydeiprra mqygaeaarlvdcraqlvaegiaalqagafhistagltyfnttpigravtgtmlvaamke dgvniwgdgstfkgndierfyryglltnpdlkiykpwldqtfidelggraemseymrqag fdykmsaek
Timeline for d5us8b1: