Lineage for d5kmwa_ (5kmw A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2217995Protein beta-Lactamase, class A [56606] (16 species)
  7. 2218101Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (26 PDB entries)
  8. 2287221Domain d5kmwa_: 5kmw A: [330522]
    automated match to d2wyxa_
    complexed with pnm, pnn, so4; mutant

Details for d5kmwa_

PDB Entry: 5kmw (more details), 1.1 Å

PDB Description: toho1 beta lactamase mutant e166a/r274n/r276n -benzyl penicillin complex
PDB Compounds: (A:) beta-lactamase toho-1

SCOPe Domain Sequences for d5kmwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kmwa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
vqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdkh
llnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkvt
afarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlvt
wlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeqk
aenrndilaaaakivt

SCOPe Domain Coordinates for d5kmwa_:

Click to download the PDB-style file with coordinates for d5kmwa_.
(The format of our PDB-style files is described here.)

Timeline for d5kmwa_:

  • d5kmwa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02