SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5kmwa_ (5kmw A:)

  1. Root: SCOPe 2.06
  2. 2217451Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds)
  3. 2217740Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2217741Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2217742Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 protein domains)
  6. 2217995Protein beta-Lactamase, class A [56606] (16 species)
  7. 2218101Species Escherichia coli, TOHO-1 [TaxId:562] [56608] (26 PDB entries)
  8. 2287221Domain d5kmwa_: 5kmw A: [330522]
    automated match to d2wyxa_
    complexed with pnm, pnn, so4; mutant

Details for d5kmwa_

PDB Entry: 5kmw (more details), 1.1 Å

PDB Description: toho1 beta lactamase mutant e166a/r274n/r276n -benzyl penicillin complex
PDB Compounds: (A:) beta-lactamase toho-1

SCOPe Domain Sequences for d5kmwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5kmwa_ e.3.1.1 (A:) beta-Lactamase, class A {Escherichia coli, TOHO-1 [TaxId: 562]}
vqqqlealekssggrlgvalintadnsqilyraderfamcstskvmaaaavlkqsesdkh
llnqrveikksdlvnynpiaekhvngtmtlaelgaaalqysdntamnkliahlggpdkvt
afarslgdetfrldrtaptlntaipgdprdtttplamaqtlknltlgkalaetqraqlvt
wlkgnttgsasiraglpkswvvgdktgsgdygttndiaviwpenhaplvlvtyftqpeqk
aenrndilaaaakivt

SCOPe Domain Coordinates for d5kmwa_:

Click to download the PDB-style file with coordinates for d5kmwa_.
(The format of our PDB-style files is described here.)

Timeline for d5kmwa_:

  • d5kmwa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02