SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tihl2 (5tih L:108-212)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2020524Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 protein domains)
  6. 2024392Protein automated matches [190374] (13 species)
    not a true protein
  7. 2025381Species Mouse (Mus musculus) [TaxId:10090] [224855] (466 PDB entries)
  8. 2287218Domain d5tihl2: 5tih L:108-212 [330519]
    Other proteins in same PDB: d5tihl1
    automated match to d1p7kl2
    complexed with act

Details for d5tihl2

PDB Entry: 5tih (more details), 2.44 Å

PDB Description: structural basis for inhibition of erythrocyte invasion by antibodies to plasmodium falciparum protein cyrpa
PDB Compounds: (L:) CyRPA antibody Fab Light Chain

SCOPe Domain Sequences for d5tihl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tihl2 b.1.1.2 (L:108-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d5tihl2:

Click to download the PDB-style file with coordinates for d5tihl2.
(The format of our PDB-style files is described here.)

Timeline for d5tihl2:

  • d5tihl2 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02