Class b: All beta proteins [48724] (177 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.0: automated matches [191364] (1 protein) not a true family |
Protein automated matches [190438] (24 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187421] (74 PDB entries) |
Domain d5tkua_: 5tku A: [330515] automated match to d1p57b_ complexed with 7dk, edo, so4 |
PDB Entry: 5tku (more details), 2.12 Å
SCOPe Domain Sequences for d5tkua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5tkua_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav
Timeline for d5tkua_: