Lineage for d5tkua_ (5tku A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2387558Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2387559Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2390288Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2390289Protein automated matches [190438] (26 species)
    not a true protein
  7. 2390333Species Human (Homo sapiens) [TaxId:9606] [187421] (76 PDB entries)
  8. 2390372Domain d5tkua_: 5tku A: [330515]
    automated match to d1p57b_
    complexed with 7dk, edo, so4

Details for d5tkua_

PDB Entry: 5tku (more details), 2.12 Å

PDB Description: factor xia in complex with the inhibitor methyl ((15s)-15-(((2e)-3-(5- chloro-2-(1h-tetrazol-1-yl)phenyl)-2-propenoyl)amino)-9-oxo-8,17,19- triazatricyclo[14.2.1.0~2,7~]nonadeca-1(18),2,4,6,16(19)-pentaen-5- yl)carbamate
PDB Compounds: (A:) Factor XIa (Light Chain)

SCOPe Domain Sequences for d5tkua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tkua_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d5tkua_:

Click to download the PDB-style file with coordinates for d5tkua_.
(The format of our PDB-style files is described here.)

Timeline for d5tkua_: