SCOPe 2.08: Domain d5tx2a_: 5tx2 A:

Lineage for d5tx2a_ (5tx2 A:)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.17: Cystine-knot cytokines [57500] (1 superfamily)
   disulfide-rich fold; common core is all-beta

4. Superfamily g.17.1: Cystine-knot cytokines [57501] (8 families)

5. Family g.17.1.2: Transforming growth factor (TGF)-beta [57507] (8 proteins)

6. Protein TGF-beta2 [57510] (2 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [330451] (2 PDB entries)

8. Domain d5tx2a_: 5tx2 A: [330514]
   automated match to d2tgia_
   mutant
   missing some secondary structures that made up less than one-third of the common domain

Details for d5tx2a_

PDB Entry: 5tx2, 1.82 Å

PDB Description: miniature tgf-beta2 3-mutant monomer

PDB Compounds: (A:) Transforming growth factor beta-2

SCOPe Domain Sequences for d5tx2a_:

Sequence; same for both SEQRES and ATOM records:

>d5tx2a_ g.17.1.2 (A:) TGF-beta2 {Mouse (Mus musculus) [TaxId: 10090]}
aldaaycfrnvqdncclrplyidfkrdlgwkwihepkgynanfcagacpyraskspscvs
qdlepltilyyigntpkieqlsnmivksckcs

Timeline for d5tx2a_:

• d5tx2a_ first appeared in SCOPe 2.06
  
• d5tx2a_ appears in SCOPe 2.07