SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5jfsa_ (5jfs A:)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2195565Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2195566Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2199100Family d.144.1.0: automated matches [191359] (1 protein)
    not a true family
  6. 2199101Protein automated matches [190417] (25 species)
    not a true protein
  7. 2199241Species Human (Homo sapiens) [TaxId:9606] [187294] (808 PDB entries)
  8. 2287209Domain d5jfsa_: 5jfs A: [330510]
    automated match to d4asea_
    complexed with 6k0

Details for d5jfsa_

PDB Entry: 5jfs (more details), 2.07 Å

PDB Description: crystal structure of trka in complex with pf-00593174
PDB Compounds: (A:) high affinity nerve growth factor receptor

SCOPe Domain Sequences for d5jfsa_:

Sequence, based on SEQRES records: (download)

>d5jfsa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mhhhhhhlvprgsvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalke
asesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpda
kllaggedvapgplglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigd
fgmsrdiystdyyrvggrtmlpirwmppesilyrkfttesdvwsfgvvlweiftygkqpw
yqlsnteaidcitqgrelerpracppevyaimrgcwqrepqqrhsikdvharlqalaqap
pvyld

Sequence, based on observed residues (ATOM records): (download)

>d5jfsa_ d.144.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mhhhhhhlvprgsvhhikrrdivlkwelgegafgkvflaechnllpeqdkmlvavkalke
asesarqdfqreaelltmlqhqhivrffgvctegrpllmvfeymrhgdlnrflrshgpva
pgplglgqllavasqvaagmvylaglhfvhrdlatrnclvgqglvvkigdfglpirwmpp
esilyrkfttesdvwsfgvvlweiftygkqpwyqlsnteaidcitqgrelerpracppev
yaimrgcwqrepqqrhsikdvharlqalaqappvyld

SCOPe Domain Coordinates for d5jfsa_:

Click to download the PDB-style file with coordinates for d5jfsa_.
(The format of our PDB-style files is described here.)

Timeline for d5jfsa_:

  • d5jfsa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02