SCOPe 2.01: Domain d2trcp_: 2trc P:

Lineage for d2trcp_ (2trc P:)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.6: Phosducin [52888] (1 protein)

6. Protein Phosducin [52889] (2 species)
   the transducin beta subunit-binding subdomain is an irregular array of helices in the N-terminal extension

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [52890] (3 PDB entries)

8. Domain d2trcp_: 2trc P: [33051]
   Other proteins in same PDB: d2trcb_, d2trcg_
   complexed with gd

Details for d2trcp_

PDB Entry: 2trc, 2.4 Å

PDB Description: phosducin/transducin beta-gamma complex

PDB Compounds: (P:) phosducin

SCOPe Domain Sequences for d2trcp_:

Sequence; same for both SEQRES and ATOM records:

>d2trcp_ c.47.1.6 (P:) Phosducin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
egqathtgpkgvindwrkfklesedgdsippskkeilrqmsspqsrddkdskermsrkms
iqeyelihqdkedegclrkyrrqcmqdmhqklsfgprygfvyeletgeqfletiekeqkv
ttivvniyedgvrgcdalnssleclaaeypmvkfckirasntgagdrfssdvlptllvyk
ggelisnfisvaeqfaedffaadvesflneygllper

Timeline for d2trcp_:

• d2trcp_ first appeared (with stable ids) in SCOP 1.55
  
• d2trcp_ appears in SCOP 1.75
  
• d2trcp_ appears in SCOPe 2.02
  
• d2trcp_ appears in the current release, SCOPe 2.08