Lineage for d5tksa_ (5tks A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2058159Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2058160Protein automated matches [190438] (24 species)
    not a true protein
  7. 2058190Species Human (Homo sapiens) [TaxId:9606] [187421] (68 PDB entries)
  8. 2287208Domain d5tksa_: 5tks A: [330509]
    automated match to d1p57b_
    complexed with 7dl, edo, so4

Details for d5tksa_

PDB Entry: 5tks (more details), 1.55 Å

PDB Description: factor xia in complex with the inhibitor ((15s)-18-chloro- 15-(((2e)- 3-(5-chloro-2-(1h-tetrazol-1-yl)phenyl)-2- propenoyl)amino)-17,19- diazatricyclo[14.2.1.0~2,7~]nonadeca-1(18),2,4,6,16(19)-pentaen-5- yl)carbamate
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d5tksa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tksa_ b.47.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvgygdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqav

SCOPe Domain Coordinates for d5tksa_:

Click to download the PDB-style file with coordinates for d5tksa_.
(The format of our PDB-style files is described here.)

Timeline for d5tksa_:

  • d5tksa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02