SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5n6ta_ (5n6t A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2082913Family c.1.8.4: Family 1 of glycosyl hydrolase [51521] (6 protein domains)
  6. 2082923Protein Beta-glucosidase A [51528] (9 species)
  7. 2082968Species Thermotoga maritima [TaxId:2336] [89475] (8 PDB entries)
    Uniprot Q08638
  8. 2287205Domain d5n6ta_: 5n6t A: [330506]
    Other proteins in same PDB: d5n6tb2
    automated match to d1oifa_
    complexed with 8p2, cl, edo

Details for d5n6ta_

PDB Entry: 5n6t (more details), 2.1 Å

PDB Description: thermotoga maritima family 1 glycoside hydrolase complexed with a cyclophellitol analogue transition state mimic
PDB Compounds: (A:) beta-glucosidase a

SCOPe Domain Sequences for d5n6ta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5n6ta_ c.1.8.4 (A:) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]}
vkkfpegflwgvatasyqiegspladgagmsiwhtfshtpgnvkngdtgdvacdhynrwk
edieiieklgvkayrfsiswprilpegtgrvnqkgldfynriidtllekgitpfvtiyhw
dlpfalqlkggwanreiadwfaeysrvlfenfgdrvknwitlnepwvvaivghlygvhap
gmrdiyvafravhnllraharavkvfretvkdgkigivfnngyfepasekeediravrfm
hqfnnyplflnpiyrgdypelvlefareylpenykddmseiqekidfvglnyysghlvkf
dpdapakvsfverdlpktamgweivpegiywilkkvkeeynppevyitengaafddvvse
dgrvhdqnridylkahigqawkaiqegvplkgyfvwslldnfewaegyskrfgivyvdys
tqkrivkdsgywysnvvknngle

SCOPe Domain Coordinates for d5n6ta_:

Click to download the PDB-style file with coordinates for d5n6ta_.
(The format of our PDB-style files is described here.)

Timeline for d5n6ta_:

  • d5n6ta_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02