Lineage for d5uwxb_ (5uwx B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2415584Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) (S)
    The phosphate moiety of substrate binds in the 'common' phosphate-binding site
  5. 2415631Family c.1.5.0: automated matches [227276] (1 protein)
    not a true family
  6. 2415632Protein automated matches [227084] (14 species)
    not a true protein
  7. 2415750Species Clostridium perfringens [TaxId:1502] [330504] (1 PDB entry)
  8. 2415751Domain d5uwxb_: 5uwx B: [330505]
    Other proteins in same PDB: d5uwxa2, d5uwxc2
    automated match to d4q33a_
    complexed with 8l7, acy, imp, mpd, mrd

Details for d5uwxb_

PDB Entry: 5uwx (more details), 1.85 Å

PDB Description: crystal structure of inosine 5'-monophosphate dehydrogenase from clostridium perfringens complexed with imp and p176
PDB Compounds: (B:) Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase

SCOPe Domain Sequences for d5uwxb_:

Sequence, based on SEQRES records: (download)

>d5uwxb_ c.1.5.0 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
arilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiam
areggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivl
dtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsictt
rivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagc
eeapgaieiyqgrsykvyrgmgslgamakgssdryfqngtkkfvpegvegriaykghlad
tiyqliggiksgmgylgaptlenlyenanfvvqtsagfreshphdinitkeapnysv

Sequence, based on observed residues (ATOM records): (download)

>d5uwxb_ c.1.5.0 (B:) automated matches {Clostridium perfringens [TaxId: 1502]}
arilktaytfddvllvpnksevlpnevslktqltkkiqlniplmsasmdtvteskmaiam
areggigiihknmtiedqarevdrvkrsggllcgasigvtndmmervdavvkakvdvivl
dtahghskgviegvkrikakypelqviagniatpeavrdlaeagadcvkvgigpgsictt
rivagvgvpqltavmdcaeegkklgipviadgglkysgdivkalaagacaammgsifagc
eeapgaieiyqgrsykvyrgmgslgamakfvpegvegriaykghladtiyqliggiksgm
gylgaptlenlyenanfvvqtsagfreshphdinitkeapnysv

SCOPe Domain Coordinates for d5uwxb_:

Click to download the PDB-style file with coordinates for d5uwxb_.
(The format of our PDB-style files is described here.)

Timeline for d5uwxb_: