SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5x47f_ (5x47 F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2101600Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2103506Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2103920Family c.23.13.0: automated matches [191662] (1 protein)
    not a true family
  6. 2103921Protein automated matches [191250] (3 species)
    not a true protein
  7. 2103922Species Acinetobacter baumannii [TaxId:400667] [260788] (6 PDB entries)
  8. 2287200Domain d5x47f_: 5x47 F: [330501]
    automated match to d4rc9a_

Details for d5x47f_

PDB Entry: 5x47 (more details), 2.54 Å

PDB Description: crystal structure of dehydroquinate dehydratase from acinetobacter baumannii at 2.5 angstrom resolution
PDB Compounds: (F:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d5x47f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5x47f_ c.23.13.0 (F:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
sstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdr
ihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdk
aigvicglgakgysfaldyaiekiq

SCOPe Domain Coordinates for d5x47f_:

Click to download the PDB-style file with coordinates for d5x47f_.
(The format of our PDB-style files is described here.)

Timeline for d5x47f_:

  • d5x47f_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02