![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) ![]() |
![]() | Family c.23.13.0: automated matches [191662] (1 protein) not a true family |
![]() | Protein automated matches [191250] (3 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:400667] [260788] (7 PDB entries) |
![]() | Domain d5x47j_: 5x47 J: [330497] automated match to d4rc9a_ |
PDB Entry: 5x47 (more details), 2.54 Å
SCOPe Domain Sequences for d5x47j_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5x47j_ c.23.13.0 (J:) automated matches {Acinetobacter baumannii [TaxId: 400667]} sstilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdr ihqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdk aigvicglgakgysfaldyaiekiq
Timeline for d5x47j_: