Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.5: Inosine monophosphate dehydrogenase (IMPDH) [51412] (2 families) The phosphate moiety of substrate binds in the 'common' phosphate-binding site |
Family c.1.5.0: automated matches [227276] (1 protein) not a true family |
Protein automated matches [227084] (16 species) not a true protein |
Species Campylobacter jejuni [TaxId:398000] [330482] (4 PDB entries) |
Domain d5uqfb1: 5uqf B:1-482 [330488] Other proteins in same PDB: d5uqfa2, d5uqfb2, d5uqfc2 automated match to d4mz8b_ complexed with 8ky, cl, edo, gol, imp, k, so4 |
PDB Entry: 5uqf (more details), 2.73 Å
SCOPe Domain Sequences for d5uqfb1:
Sequence, based on SEQRES records: (download)
>d5uqfb1 c.1.5.0 (B:1-482) automated matches {Campylobacter jejuni [TaxId: 398000]} mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm arlgglgvihknmdiasqvrevkrvkksesggikdlkkrkeypdankdnfgrlrvgaaig vgqmdrvdalveagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakal ceagvdavkvgigpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdi akalavgassvmigsllagtdespgelftyqgrqyksyrgmgslgamqkgssdryfqqgt aqdklvpegiegrvpyvgsirsvvhqllgglrssmgyvgakdiedfqkraefveittagl keshvhdvtitheapnykv
>d5uqfb1 c.1.5.0 (B:1-482) automated matches {Campylobacter jejuni [TaxId: 398000]} mkivkraltfedvllrpgysevlpkevkihtkltknitlnmplisaamdtvtehraaimm arlgglgvihknmdiasqvrevkrvkkskeypdankdnfgrlrvgaaigvgqmdrvdalv eagvdvvvldsahghskgiidtvkaikakypnldliagniataaaakalceagvdavkvg igpgsicttrivsgvgvpqisaidecveeankfgvpviadggikysgdiakalavgassv migsllagtdespgelftyqgrqyksyrgmgslgamqkklvpegiegrvpyvgsirsvvh qllgglrssmgyvgakdiedfqkraefveittaglkeshvhdvtitheapnykv
Timeline for d5uqfb1:
View in 3D Domains from other chains: (mouse over for more information) d5uqfa1, d5uqfa2, d5uqfc1, d5uqfc2 |