Lineage for d5sxpa_ (5sxp A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2046151Protein automated matches [190043] (6 species)
    not a true protein
  7. 2046216Species Norway rat (Rattus norvegicus) [TaxId:10116] [187407] (8 PDB entries)
  8. 2287180Domain d5sxpa_: 5sxp A: [330481]
    automated match to d2ak5a_

Details for d5sxpa_

PDB Entry: 5sxp (more details), 1.65 Å

PDB Description: structural basis for the interaction between itch prr and beta-pix
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d5sxpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sxpa_ b.34.2.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
snnqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegtlngrtgwfpsnyvrevk
a

SCOPe Domain Coordinates for d5sxpa_:

Click to download the PDB-style file with coordinates for d5sxpa_.
(The format of our PDB-style files is described here.)

Timeline for d5sxpa_:

  • d5sxpa_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02