SCOP 1.55: Domain d1g6wd2: 1g6w D:96-200

Lineage for d1g6wd2 (1g6w D:96-200)

1. Root: SCOP 1.55

2. Class c: Alpha and beta proteins (a/b) [51349] (97 folds)

3. Fold c.47: Thioredoxin fold [52832] (3 superfamilies)

4. Superfamily c.47.1: Thioredoxin-like [52833] (10 families)

5. Family c.47.1.5: Glutathione S-transferases, N-terminal domain [52862] (2 proteins)

6. Protein Yeast prion protein ure2p, nitrogen regulation fragment [52886] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52887] (3 PDB entries)

8. Domain d1g6wd2: 1g6w D:96-200 [33048]
   Other proteins in same PDB: d1g6wa1, d1g6wb1, d1g6wc1, d1g6wd1

Details for d1g6wd2

PDB Entry: 1g6w, 2.5 Å

PDB Description: crystal structure of the globular region of the prion protein ure2 from the yeast saccaromyces cerevisiae

SCOP Domain Sequences for d1g6wd2:

Sequence; same for both SEQRES and ATOM records:

>d1g6wd2 c.47.1.5 (D:96-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae)}
hveysritkffqeqplegytlfshrsapngfkvaivlselgfhyntifldfnlgehrape
fvsvnpnarvpalidhgmdnlsiwesgaillhlvnkyyketgnpl

Timeline for d1g6wd2:

• d1g6wd2 appears in SCOP 1.57
  
• d1g6wd2 appears in the current release, SCOPe 2.08