SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5t25a1 (5t25 A:1-292)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2085157Family c.1.10.1: Class I aldolase [51570] (13 protein domains)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2085288Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2280505Species Escherichia coli [TaxId:585034] [323806] (2 PDB entries)
  8. 2287175Domain d5t25a1: 5t25 A:1-292 [330476]
    Other proteins in same PDB: d5t25a2
    automated match to d3du0a_
    complexed with lys, na

Details for d5t25a1

PDB Entry: 5t25 (more details), 1.99 Å

PDB Description: kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d5t25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t25a1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 585034]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigixeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOPe Domain Coordinates for d5t25a1:

Click to download the PDB-style file with coordinates for d5t25a1.
(The format of our PDB-style files is described here.)

Timeline for d5t25a1:

  • d5t25a1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5t25a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5t25b_