Lineage for d5t25a1 (5t25 A:1-292)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2834402Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2834403Family c.1.10.1: Class I aldolase [51570] (13 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 2834536Protein Dihydrodipicolinate synthase [51574] (13 species)
  7. 2834616Species Escherichia coli [TaxId:585034] [323806] (2 PDB entries)
  8. 2834617Domain d5t25a1: 5t25 A:1-292 [330476]
    Other proteins in same PDB: d5t25a2
    automated match to d3du0a_
    complexed with lys, na

    has additional insertions and/or extensions that are not grouped together

Details for d5t25a1

PDB Entry: 5t25 (more details), 1.99 Å

PDB Description: kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
PDB Compounds: (A:) 4-hydroxy-tetrahydrodipicolinate synthase

SCOPe Domain Sequences for d5t25a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5t25a1 c.1.10.1 (A:1-292) Dihydrodipicolinate synthase {Escherichia coli [TaxId: 585034]}
mftgsivaivtpmdekgnvcraslkklidyhvasgtsaivsvgttgesatlnhdehadvv
mmtldladgripviagtganataeaisltqrfndsgivgcltvtpyynrpsqeglyqhfk
aiaehtdlpqilynvpsrtgcdllpetvgrlakvkniigixeatgnltrvnqikelvsdd
fvllsgddasaldfmqlgghgvisvtanvaardmaqmcklaaeghfaearvinqrlmplh
nklfvepnpipvkwackelglvatdtlrlpmtpitdsgretvraalkhagll

SCOPe Domain Coordinates for d5t25a1:

Click to download the PDB-style file with coordinates for d5t25a1.
(The format of our PDB-style files is described here.)

Timeline for d5t25a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5t25a2
View in 3D
Domains from other chains:
(mouse over for more information)
d5t25b_