Lineage for d5sxpc_ (5sxp C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2782861Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2782862Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 2783254Protein automated matches [190043] (8 species)
    not a true protein
  7. 2783282Species Human (Homo sapiens) [TaxId:9606] [187799] (37 PDB entries)
  8. 2783315Domain d5sxpc_: 5sxp C: [330473]
    automated match to d2ak5a_

Details for d5sxpc_

PDB Entry: 5sxp (more details), 1.65 Å

PDB Description: structural basis for the interaction between itch prr and beta-pix
PDB Compounds: (C:) Rho guanine nucleotide exchange factor 7

SCOPe Domain Sequences for d5sxpc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sxpc_ b.34.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nnqlvvrakfnfqqtnedelsfskgdvihvtrveeggwwegtlngrtgwfpsnyvrevka

SCOPe Domain Coordinates for d5sxpc_:

Click to download the PDB-style file with coordinates for d5sxpc_.
(The format of our PDB-style files is described here.)

Timeline for d5sxpc_: