SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tl9a_ (5tl9 A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2228877Fold f.56: MAPEG domain-like [161083] (1 superfamily)
    4 helices, bundle; left-handed superhelix
  4. 2228878Superfamily f.56.1: MAPEG domain-like [161084] (2 families) (S)
  5. 2228914Family f.56.1.0: automated matches [193735] (1 protein)
    not a true family
  6. 2228915Protein automated matches [193736] (1 species)
    not a true protein
  7. 2228916Species Human (Homo sapiens) [TaxId:9606] [193737] (13 PDB entries)
  8. 2287170Domain d5tl9a_: 5tl9 A: [330471]
    automated match to d4yl1a_
    complexed with 7dn, bog, gsh, jzr, peg, pg4

Details for d5tl9a_

PDB Entry: 5tl9 (more details), 1.2 Å

PDB Description: crystal structure of mpges-1 bound to inhibitor
PDB Compounds: (A:) Prostaglandin E synthase

SCOPe Domain Sequences for d5tl9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tl9a_ f.56.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slvmsspalpafllcstllvikmyvvaiitgqvrlrkkafanpedalrhggpqycrsdpd
verclrahrndmetiypflflgfvysflgpnpfvawmhflvflvgrvahtvaylgklrap
irsvtytlaqlpcasmalqilweaarhl

SCOPe Domain Coordinates for d5tl9a_:

Click to download the PDB-style file with coordinates for d5tl9a_.
(The format of our PDB-style files is described here.)

Timeline for d5tl9a_:

  • d5tl9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02