Lineage for d5tl9a_ (5tl9 A:)

  1. Root: SCOPe 2.06
  2. 2223823Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2228877Fold f.56: MAPEG domain-like [161083] (1 superfamily)
    4 helices, bundle; left-handed superhelix
  4. 2228878Superfamily f.56.1: MAPEG domain-like [161084] (2 families) (S)
  5. 2228914Family f.56.1.0: automated matches [193735] (1 protein)
    not a true family
  6. 2228915Protein automated matches [193736] (1 species)
    not a true protein
  7. 2228916Species Human (Homo sapiens) [TaxId:9606] [193737] (13 PDB entries)
  8. 2287170Domain d5tl9a_: 5tl9 A: [330471]
    automated match to d4yl1a_
    complexed with 7dn, bog, gsh, jzr, peg, pg4

Details for d5tl9a_

PDB Entry: 5tl9 (more details), 1.2 Å

PDB Description: crystal structure of mpges-1 bound to inhibitor
PDB Compounds: (A:) Prostaglandin E synthase

SCOPe Domain Sequences for d5tl9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tl9a_ f.56.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
slvmsspalpafllcstllvikmyvvaiitgqvrlrkkafanpedalrhggpqycrsdpd
verclrahrndmetiypflflgfvysflgpnpfvawmhflvflvgrvahtvaylgklrap
irsvtytlaqlpcasmalqilweaarhl

SCOPe Domain Coordinates for d5tl9a_:

Click to download the PDB-style file with coordinates for d5tl9a_.
(The format of our PDB-style files is described here.)

Timeline for d5tl9a_:

  • d5tl9a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02