SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5totb1 (5tot B:0-411)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2130992Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2131336Protein automated matches [190317] (5 species)
    not a true protein
  7. 2287144Species Sus scrofa [TaxId:9823] [330445] (4 PDB entries)
  8. 2287162Domain d5totb1: 5tot B:0-411 [330463]
    Other proteins in same PDB: d5tota2, d5totb2
    automated match to d3wzfa_
    mutant

Details for d5totb1

PDB Entry: 5tot (more details), 1.4 Å

PDB Description: crystal structure of aat h143l:h189l double mutant
PDB Compounds: (B:) Aspartate aminotransferase, cytoplasmic

SCOPe Domain Sequences for d5totb1:

Sequence, based on SEQRES records: (download)

>d5totb1 c.67.1.1 (B:0-411) automated matches {Sus scrofa [TaxId: 9823]}
mappsvfaevpqaqpvlvfkliadfredpdprkvnlgvgayrtddcqpwvlpvvrkveqr
iannsslnheylpilglaefrtcasrlalgddspalqekrvggvqslggtgalrigaefl
arwyngtnnkdtpvyvssptwenlngvfttagfkdirsyrywdtekrgldlqgflsdlen
apefsifvllacahnptgtdptpeqwkqiasvmkrrflfpffdsayqgfasgnlekdawa
iryfvsegfelfcaqsfsknfglynervgnltvvakepdsilrvlsqmqkivrvtwsnpp
aqgarivartlsdpelfhewtgnvktmadrilsmrselrarlealktpgtwnhitdqigm
fsftglnpkqveylinqkhiyllpsgrinmcglttknldyvatsiheavtki

Sequence, based on observed residues (ATOM records): (download)

>d5totb1 c.67.1.1 (B:0-411) automated matches {Sus scrofa [TaxId: 9823]}
mappsvfaevpqaqprkvnlgvgayrtddcqpwvlpvvrkveqriannsslnheylpilg
laefrtcasrlalgddspalqekrvggvqslggtgalrigaeflarwyngtnnkdtpvyv
ssptwenlngvfttagfkdirsyrywdtekrgldlqgflsdlenapefsifvllacahnp
tgtdptpeqwkqiasvmkrrflfpffdsayqgfasgnlekdawairyfvsegfelfcaqs
fsknfglynervgnltvvakepdsilrvlsqmqkivrvtwsnppaqgarivartlsdpel
fhewtgnvktmadrilsmrselrarlealktpgtwnhitdqigmfsftglnpkqveylin
qkhiyllpsgrinmcglttknldyvatsiheavtki

SCOPe Domain Coordinates for d5totb1:

Click to download the PDB-style file with coordinates for d5totb1.
(The format of our PDB-style files is described here.)

Timeline for d5totb1:

  • d5totb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02

View in 3D
Domains from same chain:
(mouse over for more information)
d5totb2