SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5ttdb1 (5ttd B:13-375)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (26 species)
    not a true protein
  7. 2287159Species Streptococcus pyogenes [TaxId:1314] [330460] (1 PDB entry)
  8. 2287160Domain d5ttdb1: 5ttd B:13-375 [330461]
    Other proteins in same PDB: d5ttdb2
    automated match to d4ys9b_
    complexed with fmt, mlr

Details for d5ttdb1

PDB Entry: 5ttd (more details), 2 Å

PDB Description: minor pilin fctb from s. pyogenes with engineered intramolecular isopeptide bond
PDB Compounds: (B:) Maltose-binding periplasmic protein,Pilin isopeptide linkage domain protein

SCOPe Domain Sequences for d5ttdb1:

Sequence, based on SEQRES records: (download)

>d5ttdb1 c.94.1.1 (B:13-375) automated matches {Streptococcus pyogenes [TaxId: 1314]}
lviwingdkgynglaqvgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwahdr
fggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnpp
ktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdna
gakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtv
lptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalks
yeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqt
nag

Sequence, based on observed residues (ATOM records): (download)

>d5ttdb1 c.94.1.1 (B:13-375) automated matches {Streptococcus pyogenes [TaxId: 1314]}
lviwingdkgynglaqvgkkfekdtgikvtvehpdkleekfpqvagpdiifwahdrfggy
aqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnppktwe
eipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdnagaka
gltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlptf
kgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalksyeee
lakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqtnag

SCOPe Domain Coordinates for d5ttdb1:

Click to download the PDB-style file with coordinates for d5ttdb1.
(The format of our PDB-style files is described here.)

Timeline for d5ttdb1:

  • d5ttdb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02