Lineage for d5ttdb1 (5ttd B:13-375)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2144293Family c.94.1.1: Phosphate binding protein-like [53851] (45 protein domains)
  6. 2145191Protein automated matches [190140] (27 species)
    not a true protein
  7. 2287159Species Streptococcus pyogenes [TaxId:1314] [330460] (1 PDB entry)
  8. 2287160Domain d5ttdb1: 5ttd B:13-375 [330461]
    Other proteins in same PDB: d5ttdb2
    automated match to d4ys9b_
    complexed with fmt, mlr

Details for d5ttdb1

PDB Entry: 5ttd (more details), 2 Å

PDB Description: minor pilin fctb from s. pyogenes with engineered intramolecular isopeptide bond
PDB Compounds: (B:) Maltose-binding periplasmic protein,Pilin isopeptide linkage domain protein

SCOPe Domain Sequences for d5ttdb1:

Sequence, based on SEQRES records: (download)

>d5ttdb1 c.94.1.1 (B:13-375) automated matches {Streptococcus pyogenes [TaxId: 1314]}
lviwingdkgynglaqvgkkfekdtgikvtvehpdkleekfpqvaatgdgpdiifwahdr
fggyaqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnpp
ktweeipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdna
gakagltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtv
lptfkgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalks
yeeelakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqt
nag

Sequence, based on observed residues (ATOM records): (download)

>d5ttdb1 c.94.1.1 (B:13-375) automated matches {Streptococcus pyogenes [TaxId: 1314]}
lviwingdkgynglaqvgkkfekdtgikvtvehpdkleekfpqvagpdiifwahdrfggy
aqsgllaeitpdkafqdklypftwdavryngkliaypiavealsliynkdllpnppktwe
eipaldkelkakgksalmfnlqepyftwpliaadggyafkyengkydikdvgvdnagaka
gltflvdliknkhmnadtdysiaeaafnkgetamtingpwawsnidtskvnygvtvlptf
kgqpskpfvgvlsaginaaspnkelakeflenylltdegleavnkdkplgavalksyeee
lakdpriaatmenaqkgeimpnipqmsafwyavrtavinaasgrqtvdealkdaqtnag

SCOPe Domain Coordinates for d5ttdb1:

Click to download the PDB-style file with coordinates for d5ttdb1.
(The format of our PDB-style files is described here.)

Timeline for d5ttdb1:

  • d5ttdb1 appears in periodic updates to SCOPe 2.06 starting on 2017-03-02