Lineage for d5tonb1 (5ton B:0-411)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2470825Family c.67.1.1: AAT-like [53384] (17 protein domains)
  6. 2470885Protein Aspartate aminotransferase, AAT [53385] (9 species)
  7. 2471034Species Pig (Sus scrofa), cytosolic form [TaxId:9823] [53388] (8 PDB entries)
  8. 2471042Domain d5tonb1: 5ton B:0-411 [330458]
    Other proteins in same PDB: d5tona2, d5tonb2
    automated match to d3wzfa_
    mutant

Details for d5tonb1

PDB Entry: 5ton (more details), 1.4 Å

PDB Description: crystal structure of aat h143l mutant
PDB Compounds: (B:) Aspartate aminotransferase, cytoplasmic

SCOPe Domain Sequences for d5tonb1:

Sequence, based on SEQRES records: (download)

>d5tonb1 c.67.1.1 (B:0-411) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]}
mappsvfaevpqaqpvlvfkliadfredpdprkvnlgvgayrtddcqpwvlpvvrkveqr
iannsslnheylpilglaefrtcasrlalgddspalqekrvggvqslggtgalrigaefl
arwyngtnnkdtpvyvssptwenlngvfttagfkdirsyrywdtekrgldlqgflsdlen
apefsifvlhacahnptgtdptpeqwkqiasvmkrrflfpffdsayqgfasgnlekdawa
iryfvsegfelfcaqsfsknfglynervgnltvvakepdsilrvlsqmqkivrvtwsnpp
aqgarivartlsdpelfhewtgnvktmadrilsmrselrarlealktpgtwnhitdqigm
fsftglnpkqveylinqkhiyllpsgrinmcglttknldyvatsiheavtki

Sequence, based on observed residues (ATOM records): (download)

>d5tonb1 c.67.1.1 (B:0-411) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]}
mappsvfaevpqaqpvvnlgvgayrtddcqpwvlpvvrkveqriannsslnheylpilgl
aefrtcasrlalgddspalqekrvggvqslggtgalrigaeflarwyngtnnkdtpvyvs
sptwenlngvfttagfkdirsyrywdtekrgldlqgflsdlenapefsifvlhacahnpt
gtdptpeqwkqiasvmkrrflfpffdsayqgfasgnlekdawairyfvsegfelfcaqsf
sknfglynervgnltvvakepdsilrvlsqmqkivrvtwsnppaqgarivartlsdpelf
hewtgnvktmadrilsmrselrarlealktpgtwnhitdqigmfsftglnpkqveylinq
khiyllpsgrinmcglttknldyvatsiheavtki

SCOPe Domain Coordinates for d5tonb1:

Click to download the PDB-style file with coordinates for d5tonb1.
(The format of our PDB-style files is described here.)

Timeline for d5tonb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5tonb2