SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d5tx4a_ (5tx4 A:)

  1. Root: SCOPe 2.06
  2. 2229111Class g: Small proteins [56992] (94 folds)
  3. 2231239Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2231240Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2231465Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 protein domains)
  6. 2231502Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 2231505Species Human (Homo sapiens) [TaxId:9606] [69952] (8 PDB entries)
  8. 2287156Domain d5tx4a_: 5tx4 A: [330457]
    Other proteins in same PDB: d5tx4b_
    automated match to d1ploa_

Details for d5tx4a_

PDB Entry: 5tx4 (more details), 1.88 Å

PDB Description: derivative of mouse tgf-beta2, with a deletion of residues 52-71 and k25r, r26k, l51r, a74k, c77s, l89v, i92v, k94r t95k, i98v single amino acid substitutions, bound to human tgf-beta type ii receptor ectodomain residues 15-130
PDB Compounds: (A:) TGF-beta receptor type-2

SCOPe Domain Sequences for d5tx4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5tx4a_ g.7.1.3 (A:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]}
avkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitletvchd
pklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniifs

SCOPe Domain Coordinates for d5tx4a_:

Click to download the PDB-style file with coordinates for d5tx4a_.
(The format of our PDB-style files is described here.)

Timeline for d5tx4a_:

  • d5tx4a_ appears in periodic updates to SCOPe 2.06 starting on 2017-03-02

View in 3D
Domains from other chains:
(mouse over for more information)
d5tx4b_